Total number of results for Trachemys scripta are 10
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00808 |
RPPGFTPFR
|
9 | Trachemys scripta | Bradykinin | [Thr6]-bradykinin | 2298179#Conlon JM, Hicks JW, Smith DD#Isolation and biological activity of a novel kinin ([Thr6] bradykinin) from the turtle, Pseudemys scripta#Endocrinology 1990 Feb;126(2):985-91 | |
NP02220 |
QQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
|
110 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02221 |
RLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF
|
58 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-58 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02222 |
YLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF
|
40 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-40 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02223 |
GPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF
|
33 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-33 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02224 |
DYMGWMDF
|
8 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-8 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02225 |
YMGWMDF
|
7 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-7 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02438 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMST
|
29 | Trachemys scripta | Glucagon | Glucagon | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). | |
NP02748 |
AANQHLCGSHLVEALYLVCGERGFFYSPKA
|
30 | Trachemys scripta | Insulin | Insulin B chain | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). | |
NP02749 |
GIVEQCCHNTCSLYQLENYCN
|
21 | Trachemys scripta | Insulin | Insulin A chain | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). |